PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0311s0230.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 247aa    MW: 28394.9 Da    PI: 7.5457
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0311s0230.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM94.81.4e-2957754128
                     NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   +  g+kk Lvfy g+ap+g kt+W+mheyrl
  SapurV1A.0311s0230.2.p   5 GEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGR--PKPLGIKKALVFYAGKAPRGIKTNWIMHEYRL 77 
                             579************************************98..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100540.8061103IPR003441NAC domain
SuperFamilySSF1019414.18E-363103IPR003441NAC domain
PfamPF023654.0E-14977IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPIGRPKPLG IKKALVFYAG  60
KAPRGIKTNW IMHEYRLANV DRSAGKKNNL RLDDWVLCRI YNKKGSIEKH FPAERKSITK  120
YSEMEEQKPN IDEMSVYQNG RSTMGAPATM MSHSNDLLNM DTSESAPRLH TDSSCSEHVL  180
SPEFTCEKEV QSQQKLWNDE LDNALDFNFN YIDDGFQDDP FASQVQFQMD QLSPLQDMFM  240
YSQRPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-50210964174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2237841e-156CU223784.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306280.11e-171hypothetical protein POPTR_0005s07060g
SwissprotQ390134e-95NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9H4N31e-171B9H4N3_POPTR; Uncharacterized protein
STRINGPOPTR_0005s07060.11e-170(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-96NAC family protein